RPS6KA3 polyclonal antibody
  • RPS6KA3 polyclonal antibody

RPS6KA3 polyclonal antibody

Ref: AB-PAB29387
RPS6KA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human RPS6KA3.
Información adicional
Size 100 uL
Gene Name RPS6KA3
Gene Alias CLS|HU-3|ISPK-1|MAPKAPK1B|MRX19|RSK|RSK2|S6K-alpha3|p90-RSK2|pp90RSK2
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RPS6KA3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6197
Iso type IgG

Enviar uma mensagem


RPS6KA3 polyclonal antibody

RPS6KA3 polyclonal antibody