CEBPE polyclonal antibody
  • CEBPE polyclonal antibody

CEBPE polyclonal antibody

Ref: AB-PAB29383
CEBPE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CEBPE.
Información adicional
Size 100 uL
Gene Name CEBPE
Gene Alias C/EBP-epsilon|CRP1
Gene Description CCAAT/enhancer binding protein (C/EBP), epsilon
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CEBPE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1053
Iso type IgG

Enviar uma mensagem


CEBPE polyclonal antibody

CEBPE polyclonal antibody