CDKN1C polyclonal antibody
  • CDKN1C polyclonal antibody

CDKN1C polyclonal antibody

Ref: AB-PAB29381
CDKN1C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CDKN1C.
Información adicional
Size 100 uL
Gene Name CDKN1C
Gene Alias BWCR|BWS|KIP2|WBS|p57
Gene Description cyclin-dependent kinase inhibitor 1C (p57, Kip2)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CDKN1C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1028
Iso type IgG

Enviar uma mensagem


CDKN1C polyclonal antibody

CDKN1C polyclonal antibody