HSPD1 polyclonal antibody
  • HSPD1 polyclonal antibody

HSPD1 polyclonal antibody

Ref: AB-PAB29369
HSPD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human HSPD1.
Información adicional
Size 100 uL
Gene Name HSPD1
Gene Alias CPN60|GROEL|HLD4|HSP60|HSP65|HuCHA60|SPG13
Gene Description heat shock 60kDa protein 1 (chaperonin)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq RVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HSPD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3329
Iso type IgG

Enviar uma mensagem


HSPD1 polyclonal antibody

HSPD1 polyclonal antibody