NEK9 polyclonal antibody
  • NEK9 polyclonal antibody

NEK9 polyclonal antibody

Ref: AB-PAB29365
NEK9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human NEK9.
Información adicional
Size 100 uL
Gene Name NEK9
Gene Alias DKFZp434D0935|MGC138306|MGC16714|NERCC|NERCC1|Nek8
Gene Description NIMA (never in mitosis gene a)- related kinase 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq VSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHTILIVEKVLNSKTIRSNSSGLSIGTVFQSSSPGGGGGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NEK9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91754
Iso type IgG

Enviar uma mensagem


NEK9 polyclonal antibody

NEK9 polyclonal antibody