SOD1 polyclonal antibody
  • SOD1 polyclonal antibody

SOD1 polyclonal antibody

Ref: AB-PAB29364
SOD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SOD1.
Información adicional
Size 100 uL
Gene Name SOD1
Gene Alias ALS|ALS1|IPOA|SOD|homodimer
Gene Description superoxide dismutase 1, soluble
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SOD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6647
Iso type IgG

Enviar uma mensagem


SOD1 polyclonal antibody

SOD1 polyclonal antibody