USP14 polyclonal antibody
  • USP14 polyclonal antibody

USP14 polyclonal antibody

Ref: AB-PAB29362
USP14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human USP14.
Información adicional
Size 100 uL
Gene Name USP14
Gene Alias TGT
Gene Description ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq EKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9097
Iso type IgG

Enviar uma mensagem


USP14 polyclonal antibody

USP14 polyclonal antibody