IKBKB polyclonal antibody
  • IKBKB polyclonal antibody

IKBKB polyclonal antibody

Ref: AB-PAB29358
IKBKB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human IKBKB.
Información adicional
Size 100 uL
Gene Name IKBKB
Gene Alias FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB
Gene Description inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq PNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IKBKB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3551
Iso type IgG

Enviar uma mensagem


IKBKB polyclonal antibody

IKBKB polyclonal antibody