CSTA polyclonal antibody
  • CSTA polyclonal antibody

CSTA polyclonal antibody

Ref: AB-PAB29355
CSTA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CSTA.
Información adicional
Size 100 uL
Gene Name CSTA
Gene Alias STF1|STFA
Gene Description cystatin A (stefin A)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CSTA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1475
Iso type IgG

Enviar uma mensagem


CSTA polyclonal antibody

CSTA polyclonal antibody