PYGL polyclonal antibody
  • PYGL polyclonal antibody

PYGL polyclonal antibody

Ref: AB-PAB29353
PYGL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PYGL.
Información adicional
Size 100 uL
Gene Name PYGL
Gene Alias GSD6
Gene Description phosphorylase, glycogen, liver
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq MRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PYGL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5836
Iso type IgG

Enviar uma mensagem


PYGL polyclonal antibody

PYGL polyclonal antibody