CDH17 polyclonal antibody
  • CDH17 polyclonal antibody

CDH17 polyclonal antibody

Ref: AB-PAB29342
CDH17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CDH17.
Información adicional
Size 100 uL
Gene Name CDH17
Gene Alias CDH16|FLJ26931|HPT-1|HPT1|MGC138218|MGC142024
Gene Description cadherin 17, LI cadherin (liver-intestine)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDH17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1015
Iso type IgG

Enviar uma mensagem


CDH17 polyclonal antibody

CDH17 polyclonal antibody