RPL30 polyclonal antibody
  • RPL30 polyclonal antibody

RPL30 polyclonal antibody

Ref: AB-PAB29336
RPL30 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human RPL30.
Información adicional
Size 100 uL
Gene Name RPL30
Gene Alias -
Gene Description ribosomal protein L30
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq INSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPL30.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6156
Iso type IgG

Enviar uma mensagem


RPL30 polyclonal antibody

RPL30 polyclonal antibody