CASP3 polyclonal antibody
  • CASP3 polyclonal antibody

CASP3 polyclonal antibody

Ref: AB-PAB29334
CASP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CASP3.
Información adicional
Size 100 uL
Gene Name CASP3
Gene Alias CPP32|CPP32B|SCA-1
Gene Description caspase 3, apoptosis-related cysteine peptidase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CASP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 836
Iso type IgG

Enviar uma mensagem


CASP3 polyclonal antibody

CASP3 polyclonal antibody