LEF1 polyclonal antibody
  • LEF1 polyclonal antibody

LEF1 polyclonal antibody

Ref: AB-PAB29327
LEF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human LEF1.
Información adicional
Size 100 uL
Gene Name LEF1
Gene Alias DKFZp586H0919|TCF1ALPHA
Gene Description lymphoid enhancer-binding factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LEF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51176
Iso type IgG

Enviar uma mensagem


LEF1 polyclonal antibody

LEF1 polyclonal antibody