SOX6 polyclonal antibody
  • SOX6 polyclonal antibody

SOX6 polyclonal antibody

Ref: AB-PAB29321
SOX6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SOX6.
Información adicional
Size 100 uL
Gene Name SOX6
Gene Alias HSSOX6
Gene Description SRY (sex determining region Y)-box 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SOX6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55553
Iso type IgG

Enviar uma mensagem


SOX6 polyclonal antibody

SOX6 polyclonal antibody