PTK2 polyclonal antibody
  • PTK2 polyclonal antibody

PTK2 polyclonal antibody

Ref: AB-PAB29317
PTK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PTK2.
Información adicional
Size 100 uL
Gene Name PTK2
Gene Alias FADK|FAK|FAK1|pp125FAK
Gene Description PTK2 protein tyrosine kinase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PTK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5747
Iso type IgG

Enviar uma mensagem


PTK2 polyclonal antibody

PTK2 polyclonal antibody