DIABLO polyclonal antibody
  • DIABLO polyclonal antibody

DIABLO polyclonal antibody

Ref: AB-PAB29316
DIABLO polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human DIABLO.
Información adicional
Size 100 uL
Gene Name DIABLO
Gene Alias DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3
Gene Description diablo homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DIABLO.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56616
Iso type IgG

Enviar uma mensagem


DIABLO polyclonal antibody

DIABLO polyclonal antibody