NT5E polyclonal antibody
  • NT5E polyclonal antibody

NT5E polyclonal antibody

Ref: AB-PAB29314
NT5E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human NT5E.
Información adicional
Size 100 uL
Gene Name NT5E
Gene Alias CD73|E5NT|NT|NT5|NTE|eN|eNT
Gene Description 5'-nucleotidase, ecto (CD73)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 118-232 of human NT5E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4907
Iso type IgG

Enviar uma mensagem


NT5E polyclonal antibody

NT5E polyclonal antibody