CD79B polyclonal antibody
  • CD79B polyclonal antibody

CD79B polyclonal antibody

Ref: AB-PAB29311
CD79B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CD79B.
Información adicional
Size 100 uL
Gene Name CD79B
Gene Alias B29|IGB
Gene Description CD79b molecule, immunoglobulin-associated beta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 182-229 of human CD79B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 974
Iso type IgG

Enviar uma mensagem


CD79B polyclonal antibody

CD79B polyclonal antibody