MEIS2 polyclonal antibody
  • MEIS2 polyclonal antibody

MEIS2 polyclonal antibody

Ref: AB-PAB28747
MEIS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MEIS2.
Información adicional
Size 100 uL
Gene Name MEIS2
Gene Alias HsT18361|MGC2820|MRG1
Gene Description Meis homeobox 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MEIS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4212
Iso type IgG

Enviar uma mensagem


MEIS2 polyclonal antibody

MEIS2 polyclonal antibody