ZNF670 polyclonal antibody
  • ZNF670 polyclonal antibody

ZNF670 polyclonal antibody

Ref: AB-PAB28743
ZNF670 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF670.
Información adicional
Size 100 uL
Gene Name ZNF670
Gene Alias FLJ12606|MGC12466
Gene Description zinc finger protein 670
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC
Immunogen Prot. Seq DVAVAFTQEEWALLDPSQKNLYRDVMQEIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVSTGVKPC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF670.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 93474
Iso type IgG

Enviar uma mensagem


ZNF670 polyclonal antibody

ZNF670 polyclonal antibody