NXF3 polyclonal antibody
  • NXF3 polyclonal antibody

NXF3 polyclonal antibody

Ref: AB-PAB28740
NXF3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NXF3.
Información adicional
Size 100 uL
Gene Name NXF3
Gene Alias -
Gene Description nuclear RNA export factor 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq NPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNINSILELFPKLLCLDGQQSPRATLCGTEAHKRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NXF3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56000
Iso type IgG

Enviar uma mensagem


NXF3 polyclonal antibody

NXF3 polyclonal antibody