EP300 polyclonal antibody
  • EP300 polyclonal antibody

EP300 polyclonal antibody

Ref: AB-PAB28738
EP300 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EP300.
Información adicional
Size 100 uL
Gene Name EP300
Gene Alias KAT3B|p300
Gene Description E1A binding protein p300
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq FLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EP300.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2033
Iso type IgG

Enviar uma mensagem


EP300 polyclonal antibody

EP300 polyclonal antibody