MIPOL1 polyclonal antibody
  • MIPOL1 polyclonal antibody

MIPOL1 polyclonal antibody

Ref: AB-PAB28729
MIPOL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MIPOL1.
Información adicional
Size 100 uL
Gene Name MIPOL1
Gene Alias DKFZp313M2036|MGC34010
Gene Description mirror-image polydactyly 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC
Immunogen Prot. Seq KTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAIARAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSALIEERDAALSKCKRLEQELHHVKEQNQTSANNMRHLTAENNQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MIPOL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 145282
Iso type IgG

Enviar uma mensagem


MIPOL1 polyclonal antibody

MIPOL1 polyclonal antibody