ZNF777 polyclonal antibody
  • ZNF777 polyclonal antibody

ZNF777 polyclonal antibody

Ref: AB-PAB28726
ZNF777 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF777.
Información adicional
Size 100 uL
Gene Name ZNF777
Gene Alias KIAA1285
Gene Description zinc finger protein 777
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq LYKNVMRGNYESLVSMDYAISKPDLMSQMERGERPTMQEQEDSEEGETPTDPSAAHDGIVIKIEVQTNDEGSESLETPEPLMGQVEEHGFQDSELGDPCGEQPDLDMQEPENTLEESTEGSSEFSELKQMLVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF777.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27153
Iso type IgG

Enviar uma mensagem


ZNF777 polyclonal antibody

ZNF777 polyclonal antibody