OGFOD1 polyclonal antibody
  • OGFOD1 polyclonal antibody

OGFOD1 polyclonal antibody

Ref: AB-PAB28718
OGFOD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OGFOD1.
Información adicional
Size 100 uL
Gene Name OGFOD1
Gene Alias FLJ10826|KIAA1612|TPA1
Gene Description 2-oxoglutarate and iron-dependent oxygenase domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC,IF
Immunogen Prot. Seq EPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OGFOD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55239
Iso type IgG

Enviar uma mensagem


OGFOD1 polyclonal antibody

OGFOD1 polyclonal antibody