ZKSCAN5 polyclonal antibody
  • ZKSCAN5 polyclonal antibody

ZKSCAN5 polyclonal antibody

Ref: AB-PAB28714
ZKSCAN5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZKSCAN5.
Información adicional
Size 100 uL
Gene Name ZKSCAN5
Gene Alias FLJ39233|KIAA1015|MGC33710|ZFP95
Gene Description zinc finger with KRAB and SCAN domains 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC
Immunogen Prot. Seq EHHPESGEEAVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPHPLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZKSCAN5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23660
Iso type IgG

Enviar uma mensagem


ZKSCAN5 polyclonal antibody

ZKSCAN5 polyclonal antibody