TNRC6B polyclonal antibody
  • TNRC6B polyclonal antibody

TNRC6B polyclonal antibody

Ref: AB-PAB28708
TNRC6B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TNRC6B.
Información adicional
Size 100 uL
Gene Name TNRC6B
Gene Alias KIAA1093
Gene Description trinucleotide repeat containing 6B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq QIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQQQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TNRC6B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23112
Iso type IgG

Enviar uma mensagem


TNRC6B polyclonal antibody

TNRC6B polyclonal antibody