GTPBP1 polyclonal antibody
  • GTPBP1 polyclonal antibody

GTPBP1 polyclonal antibody

Ref: AB-PAB28703
GTPBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GTPBP1.
Información adicional
Size 100 uL
Gene Name GTPBP1
Gene Alias GP-1|GP1|HSPC018|MGC20069
Gene Description GTP binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq LMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GTPBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9567
Iso type IgG

Enviar uma mensagem


GTPBP1 polyclonal antibody

GTPBP1 polyclonal antibody