NSF polyclonal antibody
  • NSF polyclonal antibody

NSF polyclonal antibody

Ref: AB-PAB28698
NSF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NSF.
Información adicional
Size 100 uL
Gene Name NSF
Gene Alias SKD2
Gene Description N-ethylmaleimide-sensitive factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC,IF
Immunogen Prot. Seq KVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NSF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4905
Iso type IgG

Enviar uma mensagem


NSF polyclonal antibody

NSF polyclonal antibody