TROVE2 polyclonal antibody
  • TROVE2 polyclonal antibody

TROVE2 polyclonal antibody

Ref: AB-PAB28693
TROVE2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TROVE2.
Información adicional
Size 100 uL
Gene Name TROVE2
Gene Alias RO60|SSA2
Gene Description TROVE domain family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq FLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGF
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TROVE2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6738
Iso type IgG

Enviar uma mensagem


TROVE2 polyclonal antibody

TROVE2 polyclonal antibody