DCTPP1 polyclonal antibody
  • DCTPP1 polyclonal antibody

DCTPP1 polyclonal antibody

Ref: AB-PAB28692
DCTPP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DCTPP1.
Información adicional
Size 100 uL
Gene Name DCTPP1
Gene Alias CDA03|MGC5627|RS21C6|XTP3TPA
Gene Description dCTP pyrophosphatase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq RLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DCTPP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79077
Iso type IgG

Enviar uma mensagem


DCTPP1 polyclonal antibody

DCTPP1 polyclonal antibody