RPL11 polyclonal antibody
  • RPL11 polyclonal antibody

RPL11 polyclonal antibody

Ref: AB-PAB28685
RPL11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPL11.
Información adicional
Size 100 uL
Gene Name RPL11
Gene Alias GIG34
Gene Description ribosomal protein L11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq RAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPL11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6135
Iso type IgG

Enviar uma mensagem


RPL11 polyclonal antibody

RPL11 polyclonal antibody