FTSJ1 polyclonal antibody
  • FTSJ1 polyclonal antibody

FTSJ1 polyclonal antibody

Ref: AB-PAB28683
FTSJ1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FTSJ1.
Información adicional
Size 100 uL
Gene Name FTSJ1
Gene Alias CDLIV|JM23|MRX44|MRX9|SPB1|TRM7
Gene Description FtsJ homolog 1 (E. coli)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq FNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FTSJ1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 24140
Iso type IgG

Enviar uma mensagem


FTSJ1 polyclonal antibody

FTSJ1 polyclonal antibody