ZNF175 polyclonal antibody
  • ZNF175 polyclonal antibody

ZNF175 polyclonal antibody

Ref: AB-PAB28682
ZNF175 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF175.
Información adicional
Size 100 uL
Gene Name ZNF175
Gene Alias OTK18
Gene Description zinc finger protein 175
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq QNQIQPMSHSAFFNKKTLNTESNCEYKDPGKMIRTRPHLASSQKQPQKCCLFTESLKLNLEVNGQNESNDTEQLDDVVGSGQLFSHSSSDACSKNIHTGETFCKGNQCRKVCGHKQSLKQHQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF175.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7728
Iso type IgG

Enviar uma mensagem


ZNF175 polyclonal antibody

ZNF175 polyclonal antibody