FBXO11 polyclonal antibody
  • FBXO11 polyclonal antibody

FBXO11 polyclonal antibody

Ref: AB-PAB28680
FBXO11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBXO11.
Información adicional
Size 100 uL
Gene Name FBXO11
Gene Alias FBX11|FLJ12673|MGC44383|PRMT9|UBR6|UG063H01|VIT1
Gene Description F-box protein 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq GHRAKRARVSGKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWKESFQQLYKGAHVKPGFAEHFYSNPARYKGR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBXO11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 80204
Iso type IgG

Enviar uma mensagem


FBXO11 polyclonal antibody

FBXO11 polyclonal antibody