CPM polyclonal antibody
  • CPM polyclonal antibody

CPM polyclonal antibody

Ref: AB-PAB28679
CPM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CPM.
Información adicional
Size 100 uL
Gene Name CPM
Gene Alias -
Gene Description carboxypeptidase M
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC
Immunogen Prot. Seq LKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CPM.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1368
Iso type IgG

Enviar uma mensagem


CPM polyclonal antibody

CPM polyclonal antibody