KRT19 polyclonal antibody
  • KRT19 polyclonal antibody

KRT19 polyclonal antibody

Ref: AB-PAB28668
KRT19 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KRT19.
Información adicional
Size 100 uL
Gene Name KRT19
Gene Alias CK19|K19|K1CS|MGC15366
Gene Description keratin 19
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq TEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KRT19.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3880
Iso type IgG

Enviar uma mensagem


KRT19 polyclonal antibody

KRT19 polyclonal antibody