SNW1 polyclonal antibody
  • SNW1 polyclonal antibody

SNW1 polyclonal antibody

Ref: AB-PAB28666
SNW1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNW1.
Información adicional
Size 100 uL
Gene Name SNW1
Gene Alias Bx42|MGC119379|NCOA-62|PRPF45|Prp45|SKIIP|SKIP
Gene Description SNW domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF
Form liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNW1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22938
Iso type IgG

Enviar uma mensagem


SNW1 polyclonal antibody

SNW1 polyclonal antibody