CARS polyclonal antibody
  • CARS polyclonal antibody

CARS polyclonal antibody

Ref: AB-PAB28665
CARS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CARS.
Información adicional
Size 100 uL
Gene Name CARS
Gene Alias CARS1|CYSRS|MGC:11246
Gene Description cysteinyl-tRNA synthetase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL
Form liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:500-1:1000)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CARS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 833
Iso type IgG

Enviar uma mensagem


CARS polyclonal antibody

CARS polyclonal antibody