DPYSL2 polyclonal antibody
  • DPYSL2 polyclonal antibody

DPYSL2 polyclonal antibody

Ref: AB-PAB28663
DPYSL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DPYSL2.
Información adicional
Size 100 uL
Gene Name DPYSL2
Gene Alias CRMP2|DHPRP2|DRP-2|DRP2
Gene Description dihydropyrimidinase-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC
Immunogen Prot. Seq DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR
Form liquid
Recomended Dilution Immunohistochemistry
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DPYSL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1808
Iso type IgG

Enviar uma mensagem


DPYSL2 polyclonal antibody

DPYSL2 polyclonal antibody