SLMAP polyclonal antibody
  • SLMAP polyclonal antibody

SLMAP polyclonal antibody

Ref: AB-PAB28662
SLMAP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLMAP.
Información adicional
Size 100 uL
Gene Name SLMAP
Gene Alias FLJ42206|KIAA1601|MGC138760|MGC138761|SLAP
Gene Description sarcolemma associated protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC
Immunogen Prot. Seq SEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ
Form liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLMAP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7871
Iso type IgG

Enviar uma mensagem


SLMAP polyclonal antibody

SLMAP polyclonal antibody