RAB9A polyclonal antibody
  • RAB9A polyclonal antibody

RAB9A polyclonal antibody

Ref: AB-PAB28649
RAB9A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAB9A.
Información adicional
Size 100 uL
Gene Name RAB9A
Gene Alias RAB9
Gene Description RAB9A, member RAS oncogene family
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq SDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAB9A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9367
Iso type IgG

Enviar uma mensagem


RAB9A polyclonal antibody

RAB9A polyclonal antibody