HORMAD2 polyclonal antibody
  • HORMAD2 polyclonal antibody

HORMAD2 polyclonal antibody

Ref: AB-PAB28648
HORMAD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HORMAD2.
Información adicional
Size 100 uL
Gene Name HORMAD2
Gene Alias MGC26710
Gene Description HORMA domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HORMAD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 150280
Iso type IgG

Enviar uma mensagem


HORMAD2 polyclonal antibody

HORMAD2 polyclonal antibody