CSDC2 polyclonal antibody
  • CSDC2 polyclonal antibody

CSDC2 polyclonal antibody

Ref: AB-PAB28647
CSDC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CSDC2.
Información adicional
Size 100 uL
Gene Name CSDC2
Gene Alias PIPPIN|dJ347H13.2
Gene Description cold shock domain containing C2, RNA binding
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CSDC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27254
Iso type IgG

Enviar uma mensagem


CSDC2 polyclonal antibody

CSDC2 polyclonal antibody