RGS6 polyclonal antibody
  • RGS6 polyclonal antibody

RGS6 polyclonal antibody

Ref: AB-PAB28646
RGS6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RGS6.
Información adicional
Size 100 uL
Gene Name RGS6
Gene Alias DKFZp313G1241|FLJ43552|GAP|MGC142132
Gene Description regulator of G-protein signaling 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RGS6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9628
Iso type IgG

Enviar uma mensagem


RGS6 polyclonal antibody

RGS6 polyclonal antibody