RHOJ polyclonal antibody
  • RHOJ polyclonal antibody

RHOJ polyclonal antibody

Ref: AB-PAB28641
RHOJ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RHOJ.
Información adicional
Size 100 uL
Gene Name RHOJ
Gene Alias ARHJ|FLJ14445|MGC34777|RASL7B|TC10B|TCL
Gene Description ras homolog gene family, member J
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RHOJ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57381
Iso type IgG

Enviar uma mensagem


RHOJ polyclonal antibody

RHOJ polyclonal antibody