MAGEE1 polyclonal antibody
  • MAGEE1 polyclonal antibody

MAGEE1 polyclonal antibody

Ref: AB-PAB28639
MAGEE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAGEE1.
Información adicional
Size 100 uL
Gene Name MAGEE1
Gene Alias DAMAGE|HCA1|KIAA1587
Gene Description melanoma antigen family E, 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq STLFSSSASVDRNPSKCSLVLPSPRVTKASVDSDSEGPKGAEGPIEFEVLRDCESPNSISIMGLNTSRVAITLKPQDPMEQNVAELLQFLLVKDQSKYPIRE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAGEE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57692
Iso type IgG

Enviar uma mensagem


MAGEE1 polyclonal antibody

MAGEE1 polyclonal antibody