CTSD polyclonal antibody
  • CTSD polyclonal antibody

CTSD polyclonal antibody

Ref: AB-PAB28627
CTSD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CTSD.
Información adicional
Size 100 uL
Gene Name CTSD
Gene Alias CLN10|CPSD|MGC2311
Gene Description cathepsin D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CTSD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1509
Iso type IgG

Enviar uma mensagem


CTSD polyclonal antibody

CTSD polyclonal antibody