SPARC polyclonal antibody
  • SPARC polyclonal antibody

SPARC polyclonal antibody

Ref: AB-PAB28625
SPARC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPARC.
Información adicional
Size 100 uL
Gene Name SPARC
Gene Alias ON
Gene Description secreted protein, acidic, cysteine-rich (osteonectin)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPARC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6678
Iso type IgG

Enviar uma mensagem


SPARC polyclonal antibody

SPARC polyclonal antibody